PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42323.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 677aa    MW: 73526.6 Da    PI: 6.2674
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42323.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.72.5e-13183244162
                 XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  +++    e a+l+++
  KFK42323.1 183 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQ 244
                 678899******************************************99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-16183247IPR004827Basic-leucine zipper domain
PfamPF001702.8E-11184245IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3185245IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.44E-12187245No hitNo description
Gene3DG3DSA:1.20.5.1705.4E-17187245No hitNo description
CDDcd147042.84E-21188239No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MANPITEDPP PPLDPNPIPP FDQFHYSSSD QTPISEMMSD LGFAIDADGE FELTFDGMDD  60
LYFPAENESF LIPVNQEQFG DFTPESQGSG ISGDCVLKDV DKSTEPGLDL QTPLSSQGSD  120
NCGSDVSEAT NVVVDQKVKV EEAVTTSMTK RKKEIEEDLS DESRSSKYRR SGEDGDASGV  180
TGEEDEKKKA RLMRNRESAQ LSRQRKKHYV EELEEKVRNM HSTITDLNGK ISYFMAENAT  240
LRQQLGGNGM CPPPPMGMYP PMAPMPYPWM PCPPYMVKQQ GSQVPLIPIP RLKPHNSLGS  300
SKSKKSESKK SETKTKKVAS ISFLGLLFCL FLFGALAPIV NVNYGGISGA FYGNYRSNYV  360
TDQVYSQHRD RVLETSRSGG AGTGVSNSKG MHCGRDSDRG TGKNVSATES SVPPGNGSEP  420
LVASLFVPRN DKLVKIDGNL IINSILASEK AVASRKASES NERKADLAIP KDYSPALPLP  480
DVGRTEEMAK HLYRSKAEKQ KALSSGSADT LKDHIKTKAA NGEMQQWFRE GVAGPMFSSG  540
MCTEVFQFDV SSTSGAIIPA SSATNVSAEH GKNATHTDKR KNRRILRGIP IPLPGSNFNL  600
TEEHQRNSSS KEIKPASSMV VSVLVDPREG GDGDIDGMIG GPKSLSRVFV VVLLDSAKYV  660
TYSCVLPRSG APHLVTT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411360.10.0hypothetical protein EUTSA_v10016317mg
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A087HJM10.0A0A087HJM1_ARAAL; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein